PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0069s0110.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family TALE
Protein Properties Length: 312aa    MW: 35588 Da    PI: 5.4771
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0069s0110.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox291.8e-092542882155
                             HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                             k +yp+++++  LA+++gL+++q+ +WF N+R ++
  SapurV1A.0069s0110.1.p 254 KWPYPTEADKIALAESTGLDQKQINNWFINQRKRH 288
                             569*****************************885 PP

2ELK29.22.1e-10208229122
                     ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                             ELK+ Llr ++g++g+Lk EFs
  SapurV1A.0069s0110.1.p 208 ELKDKLLRRFGGHIGTLKREFS 229
                             9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012552.5E-2071115IPR005540KNOX1
PfamPF037901.2E-1873114IPR005540KNOX1
SMARTSM012566.2E-25121172IPR005541KNOX2
PfamPF037915.5E-24126171IPR005541KNOX2
PROSITE profilePS512139.987208228IPR005539ELK domain
SMARTSM011882.0E-6208229IPR005539ELK domain
PfamPF037893.6E-9208229IPR005539ELK domain
PROSITE profilePS5007112.552228291IPR001356Homeobox domain
SuperFamilySSF466894.02E-19229302IPR009057Homeodomain-like
SMARTSM003895.2E-13230295IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.4E-27233292IPR009057Homeodomain-like
CDDcd000861.24E-11240292No hitNo description
PfamPF059201.9E-17248287IPR008422Homeobox KN domain
PROSITE patternPS000270266289IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010073Biological Processmeristem maintenance
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MEGAYGLHST VADYSDKALM SPENLILQTE YQSLLSSETF RQRIPIHGSQ ELLSEAASIT  60
TEIQREGDMS SLIKVKIASH PSYPRLVEAY MDCQKVGAPP QTARFLDEIR RENDLFKHDA  120
VSTYWGADPE LDEFMETYCD LLVKYKSDLE RPFDEATTFL NKIEMQFRNL CTAATIRSVS  180
DGAPSSDEEL SGGELDMHEA QPSGENRELK DKLLRRFGGH IGTLKREFSK KKKKGKLPKE  240
ARQTLLGWWN AHNKWPYPTE ADKIALAEST GLDQKQINNW FINQRKRHWK PSENLQFAVM  300
DNLSGQFFTE D*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011034113.10.0PREDICTED: homeobox protein knotted-1-like 6
SwissprotQ84JS61e-140KNAT6_ARATH; Homeobox protein knotted-1-like 6
TrEMBLB9HLS50.0B9HLS5_POPTR; Uncharacterized protein
STRINGVIT_01s0127g00210.t011e-160(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62034125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.11e-135KNOTTED1-like homeobox gene 6